ZNF264 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A22873
Artikelname: ZNF264 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A22873
Hersteller Artikelnummer: A22873
Alternativnummer: ABB-A22873-100UL,ABB-A22873-20UL,ABB-A22873-500UL,ABB-A22873-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
This gene encodes a zinc finger protein and belongs to the krueppel C2H2-type zinc-finger protein family. Zinc finger proteins are often localized in the nucleus, bind nucleic acids, and regulate transcription.
Klonalität: Polyclonal
Molekulargewicht: 71kDa
NCBI: 9422
UniProt: O43296
Reinheit: Affinity purification
Sequenz: EPALSEGISLQGQVTQGNSVDSQLGQAEDQDGLSEMQEGHFRPGIDPQEKSPGKMSPECDGLGTADGVCSRIGQEQVSPGDRVRSHNSCESGKDPMIQEEE
Target-Kategorie: ZNF264
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,DNA Damage Repair. Shipping: Ice Bag
Western blot analysis of lysates from HeLa cells, using ZNF264 Rabbit pAb (A22873) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.