ZNF264 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A22873
Article Name: ZNF264 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A22873
Supplier Catalog Number: A22873
Alternative Catalog Number: ABB-A22873-100UL,ABB-A22873-20UL,ABB-A22873-500UL,ABB-A22873-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
This gene encodes a zinc finger protein and belongs to the krueppel C2H2-type zinc-finger protein family. Zinc finger proteins are often localized in the nucleus, bind nucleic acids, and regulate transcription.
Clonality: Polyclonal
Molecular Weight: 71kDa
NCBI: 9422
UniProt: O43296
Purity: Affinity purification
Sequence: EPALSEGISLQGQVTQGNSVDSQLGQAEDQDGLSEMQEGHFRPGIDPQEKSPGKMSPECDGLGTADGVCSRIGQEQVSPGDRVRSHNSCESGKDPMIQEEE
Target: ZNF264
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,DNA Damage Repair. Shipping: Ice Bag
Western blot analysis of lysates from HeLa cells, using ZNF264 Rabbit pAb (A22873) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.