Yipf6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A22875
Artikelname: Yipf6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A22875
Hersteller Artikelnummer: A22875
Alternativnummer: ABB-A22875-500UL,ABB-A22875-100UL,ABB-A22875-1000UL,ABB-A22875-20UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: A430107J06Rik, Yipf6
Enables identical protein binding activity. Acts upstream of or within intestinal epithelial cell development. Located in COPII-coated ER to Golgi transport vesicle, cis-Golgi network, and trans-Golgi network. Orthologous to human YIPF6 (Yip1 domain family member 6).
Klonalität: Polyclonal
Molekulargewicht: 26kDa
NCBI: 77929
UniProt: Q8BR70
Reinheit: Affinity purification
Sequenz: MAEAEDSPGEQEAAASKPLFAGLSDVSISQDIPIEGEITIPSRARAQEHDSSTLNESIRRTIMRDLKAVGRKFMHVLYPRKSN
Target-Kategorie: Yipf6
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: cell biology. Shipping: Ice Bag
Western blot analysis of lysates from Rat brain using Yipf6 Rabbit pAb (A22875) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Enhanced Kit (RM00021).
Exposure time:90s.