Yipf6 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A22875
Article Name: Yipf6 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A22875
Supplier Catalog Number: A22875
Alternative Catalog Number: ABB-A22875-500UL,ABB-A22875-100UL,ABB-A22875-1000UL,ABB-A22875-20UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: A430107J06Rik, Yipf6
Enables identical protein binding activity. Acts upstream of or within intestinal epithelial cell development. Located in COPII-coated ER to Golgi transport vesicle, cis-Golgi network, and trans-Golgi network. Orthologous to human YIPF6 (Yip1 domain family member 6).
Clonality: Polyclonal
Molecular Weight: 26kDa
NCBI: 77929
UniProt: Q8BR70
Purity: Affinity purification
Sequence: MAEAEDSPGEQEAAASKPLFAGLSDVSISQDIPIEGEITIPSRARAQEHDSSTLNESIRRTIMRDLKAVGRKFMHVLYPRKSN
Target: Yipf6
Antibody Type: Primary Antibody
Application Dilute: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: cell biology. Shipping: Ice Bag
Western blot analysis of lysates from Rat brain using Yipf6 Rabbit pAb (A22875) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Enhanced Kit (RM00021).
Exposure time:90s.