CD201 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A23049
- Bilder (1)
| Artikelname: | CD201 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A23049 |
| Hersteller Artikelnummer: | A23049 |
| Alternativnummer: | ABB-A23049-500UL,ABB-A23049-1000UL,ABB-A23049-100UL,ABB-A23049-20UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Mouse |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Ccca, Epcr, Ccd41, CD201 |
| Predicted to enable protein C-terminus binding activity. Predicted to be involved in negative regulation of coagulation. Predicted to act upstream of or within blood coagulation. Located in centrosome. Is expressed in several structures, including blastocyst, endocardial tissue, female reproductive system, liver, and vascular element. Orthologous to human PROCR (protein C receptor). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 27kDa |
| NCBI: | 19124 |
| UniProt: | Q64695 |
| Reinheit: | Affinity purification |
| Sequenz: | LCNSDGSQSLHMLQISYFQDNHHVRHQGNASLGKLLTHTLEGPSQNVTILQLQPWQDPESWERTESGLQIYLTQFESLVKLVYRERKENVFFPLTVSCSLGCELPEEEEEGSEPHVFFDVAVNGSAFVSFRPKTAVWVSGSQEPSKAANFTLKQLNAYNRTRYELQEFLQDTCVEFLENHITTQNMKGSQTGR |
| Target-Kategorie: | Procr |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Mouse spleen, using CD201 Rabbit pAb (A23049) at 1:600 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s. |
Produktgarantie und fachkundiger Support
