CD201 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A23049
Article Name: CD201 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A23049
Supplier Catalog Number: A23049
Alternative Catalog Number: ABB-A23049-500UL,ABB-A23049-1000UL,ABB-A23049-100UL,ABB-A23049-20UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: Ccca, Epcr, Ccd41, CD201
Predicted to enable protein C-terminus binding activity. Predicted to be involved in negative regulation of coagulation. Predicted to act upstream of or within blood coagulation. Located in centrosome. Is expressed in several structures, including blastocyst, endocardial tissue, female reproductive system, liver, and vascular element. Orthologous to human PROCR (protein C receptor).
Clonality: Polyclonal
Molecular Weight: 27kDa
NCBI: 19124
UniProt: Q64695
Purity: Affinity purification
Sequence: LCNSDGSQSLHMLQISYFQDNHHVRHQGNASLGKLLTHTLEGPSQNVTILQLQPWQDPESWERTESGLQIYLTQFESLVKLVYRERKENVFFPLTVSCSLGCELPEEEEEGSEPHVFFDVAVNGSAFVSFRPKTAVWVSGSQEPSKAANFTLKQLNAYNRTRYELQEFLQDTCVEFLENHITTQNMKGSQTGR
Target: Procr
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. Shipping: Ice Bag
Western blot analysis of lysates from Mouse spleen, using CD201 Rabbit pAb (A23049) at 1:600 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.




* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL