CD103 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A23053
- Bilder (1)
| Artikelname: | CD103 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A23053 |
| Hersteller Artikelnummer: | A23053 |
| Alternativnummer: | ABB-A23053-100UL,ABB-A23053-1000UL,ABB-A23053-20UL,ABB-A23053-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Mouse |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CD103, aM290, alpha-E1, A530055J10, alpha-M290 |
| Predicted to enable metal ion binding activity. Predicted to act upstream of or within cell adhesion and integrin-mediated signaling pathway. Located in external side of plasma membrane. Is expressed in several structures, including alimentary system, genitourinary system, lymph node, nasal septum, and nucleus pulposus. Orthologous to human ITGAE (integrin subunit alpha E). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 129kDa |
| NCBI: | 16407 |
| UniProt: | Q60677 |
| Reinheit: | Affinity purification |
| Sequenz: | EDGTEIAIVLDGSGSIEPSDFQKAKNFISTMMRNFYEKCFECNFALVQYGAVIQTEFDLQESRDINASLAKVQSIVQVKEVTKTASAMQHVLDNIFIPSRGSRKKALKVMVVLTDGDIFGDPLNLTTVINSPKMQGVVRFAIGVGDAFKNNNTYRELKLIASDPKEAHTFKVTNYSALDGLLSKLQQHIVHMEGT |
| Target-Kategorie: | Itgae |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Mouse thymus, using CD103 Rabbit pAb (A23053) at 1:900 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
