CD103 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A23053
Article Name: CD103 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A23053
Supplier Catalog Number: A23053
Alternative Catalog Number: ABB-A23053-100UL,ABB-A23053-1000UL,ABB-A23053-20UL,ABB-A23053-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CD103, aM290, alpha-E1, A530055J10, alpha-M290
Predicted to enable metal ion binding activity. Predicted to act upstream of or within cell adhesion and integrin-mediated signaling pathway. Located in external side of plasma membrane. Is expressed in several structures, including alimentary system, genitourinary system, lymph node, nasal septum, and nucleus pulposus. Orthologous to human ITGAE (integrin subunit alpha E).
Clonality: Polyclonal
Molecular Weight: 129kDa
NCBI: 16407
UniProt: Q60677
Purity: Affinity purification
Sequence: EDGTEIAIVLDGSGSIEPSDFQKAKNFISTMMRNFYEKCFECNFALVQYGAVIQTEFDLQESRDINASLAKVQSIVQVKEVTKTASAMQHVLDNIFIPSRGSRKKALKVMVVLTDGDIFGDPLNLTTVINSPKMQGVVRFAIGVGDAFKNNNTYRELKLIASDPKEAHTFKVTNYSALDGLLSKLQQHIVHMEGT
Target: Itgae
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. Shipping: Ice Bag
Western blot analysis of lysates from Mouse thymus, using CD103 Rabbit pAb (A23053) at 1:900 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.




* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL