CGPR Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A23252
Artikelname: CGPR Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A23252
Hersteller Artikelnummer: A23252
Alternativnummer: ABB-A23252-500UL,ABB-A23252-100UL,ABB-A23252-1000UL,ABB-A23252-20UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CALC2, CGRP2, CGRP-II
Predicted to enable calcitonin receptor binding activity. Predicted to be involved in adenylate cyclase-activating G protein-coupled receptor signaling pathway and regulation of cytosolic calcium ion concentration. Predicted to be located in extracellular region. Predicted to be active in extracellular space.
Klonalität: Polyclonal
Molekulargewicht: 13kDa
NCBI: 797
UniProt: P10092
Reinheit: Affinity purification
Sequenz: AGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGR
Target-Kategorie: CALCB
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Neuroscience,Cardiovascular. Shipping: Ice Bag
Western blot analysis of lysates from Mouse thymus, using CGPR Rabbit pAb (A23252) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.