CGPR Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A23252
Article Name: CGPR Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A23252
Supplier Catalog Number: A23252
Alternative Catalog Number: ABB-A23252-500UL,ABB-A23252-100UL,ABB-A23252-1000UL,ABB-A23252-20UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CALC2, CGRP2, CGRP-II
Predicted to enable calcitonin receptor binding activity. Predicted to be involved in adenylate cyclase-activating G protein-coupled receptor signaling pathway and regulation of cytosolic calcium ion concentration. Predicted to be located in extracellular region. Predicted to be active in extracellular space.
Clonality: Polyclonal
Molecular Weight: 13kDa
NCBI: 797
UniProt: P10092
Purity: Affinity purification
Sequence: AGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGR
Target: CALCB
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. ResearchArea: Neuroscience,Cardiovascular. Shipping: Ice Bag
Western blot analysis of lysates from Mouse thymus, using CGPR Rabbit pAb (A23252) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.