Arsk Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A23409
- Bilder (1)
| Artikelname: | Arsk Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A23409 |
| Hersteller Artikelnummer: | A23409 |
| Alternativnummer: | ABB-A23409-500UL,ABB-A23409-1000UL,ABB-A23409-100UL,ABB-A23409-20UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ASK, 2810429K17Rik, 4833414G15Rik, Arsk |
| Enables glucuronate-2-sulfatase activity. Predicted to be located in extracellular region and lysosome. Is expressed in aorta, genitourinary system, heart, and spinal cord. Used to study mucopolysaccharidosis. Orthologous to human ARSK (arylsulfatase family member K). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 63kDa |
| NCBI: | 77041 |
| UniProt: | Q9D2L1 |
| Reinheit: | Affinity purification |
| Sequenz: | APRTQKKRMQVNQAPNVVLVASDSFDGRLTFQPGSQVVKLPFINFMRAHGTTFLNAYTNSPICCPSRAAMWSGLFTHLTESWNNFKGLDPNYTTWMDIMEKHGYQTQKFGKVDYTSGHHSISNRVEAWTRDVAFLLRQEGRPIINLIPDKNRRRVMTKDWQNTDKAIEWLRQVNYTKPFVLYLGLNLPHPYPSPSSGENFGSSTFHTSLYWLEKVAYDAIKIPKWLTLSQMHPVDFYSSYTKNCTGKFTENEIKN |
| Target-Kategorie: | Arsk |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: ASK, 2810429K17Rik, 4833414G15Rik. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using Arsk Rabbit pAb (A23409) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 20s. |
Produktgarantie und fachkundiger Support
