Arsk Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A23409
- Images (1)
| Article Name: | Arsk Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A23409 |
| Supplier Catalog Number: | A23409 |
| Alternative Catalog Number: | ABB-A23409-500UL,ABB-A23409-1000UL,ABB-A23409-100UL,ABB-A23409-20UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | ASK, 2810429K17Rik, 4833414G15Rik, Arsk |
| Enables glucuronate-2-sulfatase activity. Predicted to be located in extracellular region and lysosome. Is expressed in aorta, genitourinary system, heart, and spinal cord. Used to study mucopolysaccharidosis. Orthologous to human ARSK (arylsulfatase family member K). |
| Clonality: | Polyclonal |
| Molecular Weight: | 63kDa |
| NCBI: | 77041 |
| UniProt: | Q9D2L1 |
| Purity: | Affinity purification |
| Sequence: | APRTQKKRMQVNQAPNVVLVASDSFDGRLTFQPGSQVVKLPFINFMRAHGTTFLNAYTNSPICCPSRAAMWSGLFTHLTESWNNFKGLDPNYTTWMDIMEKHGYQTQKFGKVDYTSGHHSISNRVEAWTRDVAFLLRQEGRPIINLIPDKNRRRVMTKDWQNTDKAIEWLRQVNYTKPFVLYLGLNLPHPYPSPSSGENFGSSTFHTSLYWLEKVAYDAIKIPKWLTLSQMHPVDFYSSYTKNCTGKFTENEIKN |
| Target: | Arsk |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human. ResearchArea: ASK, 2810429K17Rik, 4833414G15Rik. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using Arsk Rabbit pAb (A23409) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 20s. |
Product Guarantee and Expert Support
