IVD Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A23595
Artikelname: IVD Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A23595
Hersteller Artikelnummer: A23595
Alternativnummer: ABB-A23595-20UL,ABB-A23595-1000UL,ABB-A23595-500UL,ABB-A23595-100UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: IVDH, ACAD2, IVD
Isovaleryl-CoA dehydrogenase (IVD) is a mitochondrial matrix enzyme that catalyzes the third step in leucine catabolism. The genetic deficiency of IVD results in an accumulation of isovaleric acid, which is toxic to the central nervous system and leads to isovaleric acidemia. Alternatively spliced transcript variants have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 3712
UniProt: P26440
Reinheit: Affinity purification
Sequenz: HSLLPVDDAINGLSEEQRQLRQTMAKFLQEHLAPKAQEIDRSNEFKNLREFWKQLGNLGVLGITAPVQYGGSGLGYLEHVLVMEEISRASGAVGLSYGAHSNLCINQLVRNGNEAQKEKYLPKLISGE
Target-Kategorie: IVD
Application Verdünnung: WB,1:2000 - 1:7000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Amino acid metabolism. Shipping: Ice Bag
Western blot analysis of lysates from Mouse heart, using IVD Rabbit pAb (A23595) at 1:6000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.