IVD Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A23595
Article Name: IVD Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A23595
Supplier Catalog Number: A23595
Alternative Catalog Number: ABB-A23595-20UL,ABB-A23595-1000UL,ABB-A23595-500UL,ABB-A23595-100UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: IVDH, ACAD2, IVD
Isovaleryl-CoA dehydrogenase (IVD) is a mitochondrial matrix enzyme that catalyzes the third step in leucine catabolism. The genetic deficiency of IVD results in an accumulation of isovaleric acid, which is toxic to the central nervous system and leads to isovaleric acidemia. Alternatively spliced transcript variants have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 47kDa
NCBI: 3712
UniProt: P26440
Purity: Affinity purification
Sequence: HSLLPVDDAINGLSEEQRQLRQTMAKFLQEHLAPKAQEIDRSNEFKNLREFWKQLGNLGVLGITAPVQYGGSGLGYLEHVLVMEEISRASGAVGLSYGAHSNLCINQLVRNGNEAQKEKYLPKLISGE
Target: IVD
Application Dilute: WB,1:2000 - 1:7000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Amino acid metabolism. Shipping: Ice Bag
Western blot analysis of lysates from Mouse heart, using IVD Rabbit pAb (A23595) at 1:6000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.