Human IgG3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A23641
Artikelname: Human IgG3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A23641
Hersteller Artikelnummer: A23641
Alternativnummer: ABB-A23641-1000UL,ABB-A23641-20UL,ABB-A23641-500UL,ABB-A23641-100UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: IgG3, Human IgG3
Predicted to enable antigen binding activity and immunoglobulin receptor binding activity. Involved in retina homeostasis. Located in blood microparticle and extracellular exosome.
Klonalität: Polyclonal
Molekulargewicht: 41kDa
NCBI: 3502
UniProt: P01860
Reinheit: Affinity purification
Sequenz: TYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDT
Target-Kategorie: IGHG3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Immunology Inflammation. Shipping: Ice Bag
Western blot analysis of recombinant IgG3 protein using Human IgG3 Rabbit pAb (A23641) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 10ng per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.