Human IgG3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A23641
Article Name: Human IgG3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A23641
Supplier Catalog Number: A23641
Alternative Catalog Number: ABB-A23641-1000UL,ABB-A23641-20UL,ABB-A23641-500UL,ABB-A23641-100UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: IgG3, Human IgG3
Predicted to enable antigen binding activity and immunoglobulin receptor binding activity. Involved in retina homeostasis. Located in blood microparticle and extracellular exosome.
Clonality: Polyclonal
Molecular Weight: 41kDa
NCBI: 3502
UniProt: P01860
Purity: Affinity purification
Sequence: TYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDT
Target: IGHG3
Antibody Type: Primary Antibody
Application Dilute: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Immunology Inflammation. Shipping: Ice Bag
Western blot analysis of recombinant IgG3 protein using Human IgG3 Rabbit pAb (A23641) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 10ng per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.