CD119 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A23652
- Bilder (1)
| Artikelname: | CD119 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A23652 |
| Hersteller Artikelnummer: | A23652 |
| Alternativnummer: | ABB-A23652-20UL,ABB-A23652-500UL,ABB-A23652-100UL,ABB-A23652-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Mouse |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Ifgr, CD119, Ifngr, Nktar, IFN-gammaR |
| Predicted to enable cytokine receptor activity. Involved in several processes, including astrocyte activation, negative regulation of amyloid-beta clearance, and positive regulation of macromolecule metabolic process. Acts upstream of or within defense response to virus. Predicted to be located in several cellular components, including dendrite, endoplasmic reticulum, and postsynaptic density. Predicted to be integral component of plasma membrane. Is expressed in several structures, including alimentary system, cerebral cortex, cranium, female reproductive system, and liver. Used to study osteoporosis. Human ortholog(s) of this gene implicated in asthma, hepatitis B, immunodeficiency 27A, immunodeficiency 27B, and tuberculosis. Orthologous to human IFNGR1 (interferon gamma receptor 1). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 52kDa |
| NCBI: | 15979 |
| UniProt: | P15261 |
| Reinheit: | Affinity purification |
| Sequenz: | ALTSTEDPEPPSVPVPTNVLIKSYNLNPVVCWEYQNMSQTPIFTVQVKVYSGSWTDSCTNISDHCCNIYEQIMYPDVSAWARVKAKVGQKESDYARSKEFLMCLKGKVGPPGLEIRRKKEEQLSVLVFHPEVVVNGESQGTMFGDGSTCYTFDYTVYVEHNRSGEILHTKHTVEKEECNETLCELNISVSTLDSRYCISVDGISSFWQVRTEKSKDVCIPPFHDD |
| Target-Kategorie: | Ifngr1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from EL4 cells, using CD119 Rabbit pAb (A23652) at 1:3000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
