CD119 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A23652
- Images (1)
| Article Name: | CD119 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A23652 |
| Supplier Catalog Number: | A23652 |
| Alternative Catalog Number: | ABB-A23652-20UL,ABB-A23652-500UL,ABB-A23652-100UL,ABB-A23652-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Mouse |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | Ifgr, CD119, Ifngr, Nktar, IFN-gammaR |
| Predicted to enable cytokine receptor activity. Involved in several processes, including astrocyte activation, negative regulation of amyloid-beta clearance, and positive regulation of macromolecule metabolic process. Acts upstream of or within defense response to virus. Predicted to be located in several cellular components, including dendrite, endoplasmic reticulum, and postsynaptic density. Predicted to be integral component of plasma membrane. Is expressed in several structures, including alimentary system, cerebral cortex, cranium, female reproductive system, and liver. Used to study osteoporosis. Human ortholog(s) of this gene implicated in asthma, hepatitis B, immunodeficiency 27A, immunodeficiency 27B, and tuberculosis. Orthologous to human IFNGR1 (interferon gamma receptor 1). |
| Clonality: | Polyclonal |
| Molecular Weight: | 52kDa |
| NCBI: | 15979 |
| UniProt: | P15261 |
| Purity: | Affinity purification |
| Sequence: | ALTSTEDPEPPSVPVPTNVLIKSYNLNPVVCWEYQNMSQTPIFTVQVKVYSGSWTDSCTNISDHCCNIYEQIMYPDVSAWARVKAKVGQKESDYARSKEFLMCLKGKVGPPGLEIRRKKEEQLSVLVFHPEVVVNGESQGTMFGDGSTCYTFDYTVYVEHNRSGEILHTKHTVEKEECNETLCELNISVSTLDSRYCISVDGISSFWQVRTEKSKDVCIPPFHDD |
| Target: | Ifngr1 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Mouse. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from EL4 cells, using CD119 Rabbit pAb (A23652) at 1:3000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
