Epcam Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A23654
- Bilder (1)
| Artikelname: | Epcam Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A23654 |
| Hersteller Artikelnummer: | A23654 |
| Alternativnummer: | ABB-A23654-20UL,ABB-A23654-100UL,ABB-A23654-1000UL,ABB-A23654-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Mouse |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | EGP, Ly74, gp40, CD326, EGP-2, TROP1, Egp314, Ep-CAM, EpCAM1, Tacsd1, GA733-2, Tacstd1, Epcam |
| Predicted to enable cadherin binding activity involved in cell-cell adhesion. Acts upstream of or within ureteric bud development. Located in cell surface. Is expressed in several structures, including alimentary system, central nervous system, genitourinary system, respiratory system, and sensory organ. Used to study congenital diarrhea 5 with tufting enteropathy. Human ortholog(s) of this gene implicated in congenital diarrhea 5 with tufting enteropathy and hereditary nonpolyposis colorectal cancer type 8. Orthologous to human EPCAM (epithelial cell adhesion molecule). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 35kDa |
| NCBI: | 17075 |
| UniProt: | Q99JW5 |
| Reinheit: | Affinity purification |
| Sequenz: | QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT |
| Target-Kategorie: | Epcam |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using Epcam Rabbit pAb (A23654) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Produktgarantie und fachkundiger Support
