Epcam Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A23654
- Images (1)
| Article Name: | Epcam Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A23654 |
| Supplier Catalog Number: | A23654 |
| Alternative Catalog Number: | ABB-A23654-20UL,ABB-A23654-100UL,ABB-A23654-1000UL,ABB-A23654-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Mouse |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | EGP, Ly74, gp40, CD326, EGP-2, TROP1, Egp314, Ep-CAM, EpCAM1, Tacsd1, GA733-2, Tacstd1, Epcam |
| Predicted to enable cadherin binding activity involved in cell-cell adhesion. Acts upstream of or within ureteric bud development. Located in cell surface. Is expressed in several structures, including alimentary system, central nervous system, genitourinary system, respiratory system, and sensory organ. Used to study congenital diarrhea 5 with tufting enteropathy. Human ortholog(s) of this gene implicated in congenital diarrhea 5 with tufting enteropathy and hereditary nonpolyposis colorectal cancer type 8. Orthologous to human EPCAM (epithelial cell adhesion molecule). |
| Clonality: | Polyclonal |
| Molecular Weight: | 35kDa |
| NCBI: | 17075 |
| UniProt: | Q99JW5 |
| Purity: | Affinity purification |
| Sequence: | QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT |
| Target: | Epcam |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using Epcam Rabbit pAb (A23654) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Product Guarantee and Expert Support
