GPT2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A23670
Artikelname: GPT2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A23670
Hersteller Artikelnummer: A23670
Alternativnummer: ABB-A23670-1000UL,ABB-A23670-20UL,ABB-A23670-100UL,ABB-A23670-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ALT2, GPT 2, MRT49, NEDSPM, GPT2
This gene encodes a mitochondrial alanine transaminase, a pyridoxal enzyme that catalyzes the reversible transamination between alanine and 2-oxoglutarate to generate pyruvate and glutamate. Alanine transaminases play roles in gluconeogenesis and amino acid metabolism in many tissues including skeletal muscle, kidney, and liver. Activating transcription factor 4 upregulates this gene under metabolic stress conditions in hepatocyte cell lines. A loss of function mutation in this gene has been associated with developmental encephalopathy. Alternative splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 58kDa
NCBI: 84706
UniProt: Q8TD30
Reinheit: Affinity purification
Sequenz: DCRFHSFKKVLYEMGPEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVL
Target-Kategorie: GPT2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Cancer,Endocrine Metabolism,Amino acid metabolism. Shipping: Ice Bag
Western blot analysis of lysates from HepG2 cells, using GPT2 Rabbit pAb (A23670) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.