GPT2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A23670
Article Name: GPT2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A23670
Supplier Catalog Number: A23670
Alternative Catalog Number: ABB-A23670-1000UL,ABB-A23670-20UL,ABB-A23670-100UL,ABB-A23670-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ALT2, GPT 2, MRT49, NEDSPM, GPT2
This gene encodes a mitochondrial alanine transaminase, a pyridoxal enzyme that catalyzes the reversible transamination between alanine and 2-oxoglutarate to generate pyruvate and glutamate. Alanine transaminases play roles in gluconeogenesis and amino acid metabolism in many tissues including skeletal muscle, kidney, and liver. Activating transcription factor 4 upregulates this gene under metabolic stress conditions in hepatocyte cell lines. A loss of function mutation in this gene has been associated with developmental encephalopathy. Alternative splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 58kDa
NCBI: 84706
UniProt: Q8TD30
Purity: Affinity purification
Sequence: DCRFHSFKKVLYEMGPEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVL
Target: GPT2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Cancer,Endocrine Metabolism,Amino acid metabolism. Shipping: Ice Bag
Western blot analysis of lysates from HepG2 cells, using GPT2 Rabbit pAb (A23670) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.