Lyve1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A23673
- Bilder (1)
| Artikelname: | Lyve1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A23673 |
| Hersteller Artikelnummer: | A23673 |
| Alternativnummer: | ABB-A23673-100UL,ABB-A23673-1000UL,ABB-A23673-20UL,ABB-A23673-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Mouse |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Xlkd1, Lyve-1, Crsbp-1, 1200012G08Rik, Lyve1 |
| Enables hyaluronic acid binding activity and transmembrane signaling receptor activity. Acts upstream of or within glycosaminoglycan catabolic process. Located in plasma membrane. Is expressed in several structures, including cardiovascular system, gut, hemolymphoid system, meninges, and metanephros. Orthologous to human LYVE1 (lymphatic vessel endothelial hyaluronan receptor 1). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 34kDa |
| NCBI: | 114332 |
| UniProt: | Q8BHC0 |
| Reinheit: | Affinity purification |
| Sequenz: | LSISTCRIMGVALVGRNKNPQMNFTEANEACKMLGLTLASRDQVESAQKSGFETCSYGWVGEQFSVIPRIFSNPRCGKNGKGVLIWNAPSSQKFKAYCHNSSDTWVNSCIPEIVTTFYPVLDTQTPATEFSVSSSAYLASSPDSTTPVSATTRAPPLTSMARKTKKICITEVYTEPITMATETEAFVASGAAFKNEAAG |
| Target-Kategorie: | Lyve1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse,Rat. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using Lyve1 Rabbit pAb (A23673) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s. |
Produktgarantie und fachkundiger Support
