Lyve1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A23673
Article Name: Lyve1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A23673
Supplier Catalog Number: A23673
Alternative Catalog Number: ABB-A23673-100UL,ABB-A23673-1000UL,ABB-A23673-20UL,ABB-A23673-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: Xlkd1, Lyve-1, Crsbp-1, 1200012G08Rik, Lyve1
Enables hyaluronic acid binding activity and transmembrane signaling receptor activity. Acts upstream of or within glycosaminoglycan catabolic process. Located in plasma membrane. Is expressed in several structures, including cardiovascular system, gut, hemolymphoid system, meninges, and metanephros. Orthologous to human LYVE1 (lymphatic vessel endothelial hyaluronan receptor 1).
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 114332
UniProt: Q8BHC0
Purity: Affinity purification
Sequence: LSISTCRIMGVALVGRNKNPQMNFTEANEACKMLGLTLASRDQVESAQKSGFETCSYGWVGEQFSVIPRIFSNPRCGKNGKGVLIWNAPSSQKFKAYCHNSSDTWVNSCIPEIVTTFYPVLDTQTPATEFSVSSSAYLASSPDSTTPVSATTRAPPLTSMARKTKKICITEVYTEPITMATETEAFVASGAAFKNEAAG
Target: Lyve1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. Shipping: Ice Bag
Western blot analysis of various lysates, using Lyve1 Rabbit pAb (A23673) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.




* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL