CD3d Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A23883
Artikelname: CD3d Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A23883
Hersteller Artikelnummer: A23883
Alternativnummer: ABB-A23883-500UL,ABB-A23883-1000UL,ABB-A23883-100UL,ABB-A23883-20UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: T3d, CD3d
Predicted to enable identical protein binding activity and transmembrane signaling receptor activity. Involved in positive thymic T cell selection. Part of alpha-beta T cell receptor complex. Is expressed in thymus primordium. Human ortholog(s) of this gene implicated in immunodeficiency 19 and severe combined immunodeficiency. Orthologous to human CD3D (CD3d molecule).
Klonalität: Polyclonal
Molekulargewicht: 19KDa
NCBI: 12500
UniProt: P04235
Reinheit: Affinity purification
Sequenz: VLPQGSPFKIQVTEYEDKVFVTCNTSVMHLDGTVEGWFAKNKTLNLGKGVLDPRGIYLCNGTEQLAKVVSSVQVHYRMCQNCVELDSGTMAGVIFIDLIAT
Target-Kategorie: CD3d
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. Shipping: Ice Bag
Western blot analysis of various lysates, using CD3d Rabbit pAb (A23883) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.