CD3d Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A23883
Article Name: CD3d Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A23883
Supplier Catalog Number: A23883
Alternative Catalog Number: ABB-A23883-500UL,ABB-A23883-1000UL,ABB-A23883-100UL,ABB-A23883-20UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: T3d, CD3d
Predicted to enable identical protein binding activity and transmembrane signaling receptor activity. Involved in positive thymic T cell selection. Part of alpha-beta T cell receptor complex. Is expressed in thymus primordium. Human ortholog(s) of this gene implicated in immunodeficiency 19 and severe combined immunodeficiency. Orthologous to human CD3D (CD3d molecule).
Clonality: Polyclonal
Molecular Weight: 19KDa
NCBI: 12500
UniProt: P04235
Purity: Affinity purification
Sequence: VLPQGSPFKIQVTEYEDKVFVTCNTSVMHLDGTVEGWFAKNKTLNLGKGVLDPRGIYLCNGTEQLAKVVSSVQVHYRMCQNCVELDSGTMAGVIFIDLIAT
Target: CD3d
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. Shipping: Ice Bag
Western blot analysis of various lysates, using CD3d Rabbit pAb (A23883) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.