WWP2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A2425
- Bilder (1)
| Artikelname: | WWP2 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A2425 |
| Hersteller Artikelnummer: | A2425 |
| Alternativnummer: | ABB-A2425-500UL,ABB-A2425-20UL,ABB-A2425-1000UL,ABB-A2425-100UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | AIP2, WWp2-like, WWP2 |
| This gene encodes a member of the Nedd4 family of E3 ligases, which play an important role in protein ubiquitination. The encoded protein contains four WW domains and may play a role in multiple processes including chondrogenesis and the regulation of oncogenic signaling pathways via interactions with Smad proteins and the tumor suppressor PTEN. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 10. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 99kDa |
| NCBI: | 11060 |
| UniProt: | O00308 |
| Reinheit: | Affinity purification |
| Sequenz: | VPNGSALTDGSQLPSRDSSGTAVAPENRHQPPSTNCFGGRSRTHRHSGASARTTPATGEQSPGARSRHRQPVKNSGHSGLANGTVNDEPTTATDPEEPSVVGVTSPPAAPLSVTPNPNTTSLPAPATPAEGEEPSTSGTQQLPAAAQAPDALPAGWEQRELPNGRVYYVDHNTKTTTWERPLPPGWEKRTDPRGRFYYVDHNTRTTTWQRPTAEYVRNYEQWQSQRNQLQGAMQHFSQRFLYQSSSASTD |
| Target-Kategorie: | WWP2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Nuclear Receptor Signaling,Cell Biology Developmental Biology,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from A-549 cells, using WWP2 Rabbit pAb (A2425). |
Produktgarantie und fachkundiger Support
