WWP2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A2425
Article Name: WWP2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A2425
Supplier Catalog Number: A2425
Alternative Catalog Number: ABB-A2425-500UL,ABB-A2425-20UL,ABB-A2425-1000UL,ABB-A2425-100UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: AIP2, WWp2-like, WWP2
This gene encodes a member of the Nedd4 family of E3 ligases, which play an important role in protein ubiquitination. The encoded protein contains four WW domains and may play a role in multiple processes including chondrogenesis and the regulation of oncogenic signaling pathways via interactions with Smad proteins and the tumor suppressor PTEN. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 10.
Clonality: Polyclonal
Molecular Weight: 99kDa
NCBI: 11060
UniProt: O00308
Purity: Affinity purification
Sequence: VPNGSALTDGSQLPSRDSSGTAVAPENRHQPPSTNCFGGRSRTHRHSGASARTTPATGEQSPGARSRHRQPVKNSGHSGLANGTVNDEPTTATDPEEPSVVGVTSPPAAPLSVTPNPNTTSLPAPATPAEGEEPSTSGTQQLPAAAQAPDALPAGWEQRELPNGRVYYVDHNTKTTTWERPLPPGWEKRTDPRGRFYYVDHNTRTTTWQRPTAEYVRNYEQWQSQRNQLQGAMQHFSQRFLYQSSSASTD
Target: WWP2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Nuclear Receptor Signaling,Cell Biology Developmental Biology,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway. Shipping: Ice Bag
Western blot analysis of lysates from A-549 cells, using WWP2 Rabbit pAb (A2425).