TXNIP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A24289
Artikelname: TXNIP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A24289
Hersteller Artikelnummer: A24289
Alternativnummer: ABB-A24289-500UL,ABB-A24289-100UL,ABB-A24289-1000UL,ABB-A24289-20UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: THIF, VDUP1, ARRDC6, HHCPA78, EST01027, TXNIP
This gene encodes a thioredoxin-binding protein that is a member of the alpha arrestin protein family. Thioredoxin is a thiol-oxidoreductase that is a major regulator of cellular redox signaling which protects cells from oxidative stress. This protein inhibits the antioxidative function of thioredoxin resulting in the accumulation of reactive oxygen species and cellular stress. This protein also functions as a regulator of cellular metabolism and of endoplasmic reticulum (ER) stress. This protein may also function as a tumor suppressor. Alternate splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 10628
UniProt: Q9H3M7
Reinheit: Affinity purification
Sequenz: DLPLVIGSRSGLSSRTSSMASRTSSEMSWVDLNIPDTPEAPPCYMDVIPEDHRLESPTTPLLDDMDGSQDSPIFMYAPEFKFMPPPTYTEVDPCILNNNVQ
Target-Kategorie: TXNIP
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Nuclear Receptor Signaling,Cancer,Tumor suppressors,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Endocrine Metabolism,Carbohydrate metabolism. Shipping: Ice Bag
Western blot analysis of lysates from Mouse thymus, using TXNIP Rabbit pAb (A24289) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.