TXNIP Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A24289
Article Name: TXNIP Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A24289
Supplier Catalog Number: A24289
Alternative Catalog Number: ABB-A24289-500UL,ABB-A24289-100UL,ABB-A24289-1000UL,ABB-A24289-20UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: THIF, VDUP1, ARRDC6, HHCPA78, EST01027, TXNIP
This gene encodes a thioredoxin-binding protein that is a member of the alpha arrestin protein family. Thioredoxin is a thiol-oxidoreductase that is a major regulator of cellular redox signaling which protects cells from oxidative stress. This protein inhibits the antioxidative function of thioredoxin resulting in the accumulation of reactive oxygen species and cellular stress. This protein also functions as a regulator of cellular metabolism and of endoplasmic reticulum (ER) stress. This protein may also function as a tumor suppressor. Alternate splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 44kDa
NCBI: 10628
UniProt: Q9H3M7
Purity: Affinity purification
Sequence: DLPLVIGSRSGLSSRTSSMASRTSSEMSWVDLNIPDTPEAPPCYMDVIPEDHRLESPTTPLLDDMDGSQDSPIFMYAPEFKFMPPPTYTEVDPCILNNNVQ
Target: TXNIP
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Nuclear Receptor Signaling,Cancer,Tumor suppressors,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Endocrine Metabolism,Carbohydrate metabolism. Shipping: Ice Bag
Western blot analysis of lysates from Mouse thymus, using TXNIP Rabbit pAb (A24289) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.