ATOH8 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A24470
| Artikelname: |
ATOH8 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: |
ABB-A24470 |
| Hersteller Artikelnummer: |
A24470 |
| Alternativnummer: |
ABB-A24470-100UL,ABB-A24470-20UL,ABB-A24470-1000UL,ABB-A24470-500UL |
| Hersteller: |
ABclonal |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
ELISA, WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Synthetic peptide. This information is considered to be commercially sensitive. |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
ATOH8, HATH6, bHLHa21, protein atonal homolog 8 |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
35kDa |
| NCBI: |
84913 |
| UniProt: |
Q96SQ7 |
| Reinheit: |
Affinity purification |
| Sequenz: |
MKHIPVLEDGPWKTVCVKELNGLKKLKRKGKEPARRANGYKTFRLDLEAPEPRAVATNGLRDRTHRLQPVPVPVPVPVPVAPAVPPRGGTDTAGERGGSR |
| Target-Kategorie: |
ATOH8 |
| Antibody Type: |
Primary Antibody |
| Application Verdünnung: |
WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: |
Cross-Reactivity: Human. ResearchArea: Epigenetics & Nuclear Signaling,Transcription Factors,Cell Biology & Developmental Biology,Neuroscience. Shipping: Ice Bag |
|
Western blot analysis of lysates from RT4 cells, using ATOH8 Rabbit pAb (A24470) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 45s. |