ATOH8 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A24470
Artikelname: ATOH8 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A24470
Hersteller Artikelnummer: A24470
Alternativnummer: ABB-A24470-100UL,ABB-A24470-20UL,ABB-A24470-1000UL,ABB-A24470-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ATOH8, HATH6, bHLHa21, protein atonal homolog 8
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 84913
UniProt: Q96SQ7
Reinheit: Affinity purification
Sequenz: MKHIPVLEDGPWKTVCVKELNGLKKLKRKGKEPARRANGYKTFRLDLEAPEPRAVATNGLRDRTHRLQPVPVPVPVPVPVAPAVPPRGGTDTAGERGGSR
Target-Kategorie: ATOH8
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics & Nuclear Signaling,Transcription Factors,Cell Biology & Developmental Biology,Neuroscience. Shipping: Ice Bag
Western blot analysis of lysates from RT4 cells, using ATOH8 Rabbit pAb (A24470) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.