ATOH8 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A24470
Article Name: ATOH8 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A24470
Supplier Catalog Number: A24470
Alternative Catalog Number: ABB-A24470-100UL,ABB-A24470-20UL,ABB-A24470-1000UL,ABB-A24470-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ATOH8, HATH6, bHLHa21, protein atonal homolog 8
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 84913
UniProt: Q96SQ7
Purity: Affinity purification
Sequence: MKHIPVLEDGPWKTVCVKELNGLKKLKRKGKEPARRANGYKTFRLDLEAPEPRAVATNGLRDRTHRLQPVPVPVPVPVPVAPAVPPRGGTDTAGERGGSR
Target: ATOH8
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics & Nuclear Signaling,Transcription Factors,Cell Biology & Developmental Biology,Neuroscience. Shipping: Ice Bag
Western blot analysis of lysates from RT4 cells, using ATOH8 Rabbit pAb (A24470) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.