GIF Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A24479
- Bilder (1)
| Artikelname: | GIF Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A24479 |
| Hersteller Artikelnummer: | A24479 |
| Alternativnummer: | ABB-A24479-100UL,ABB-A24479-20UL,ABB-A24479-500UL,ABB-A24479-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GIF, IF, IFMH, INF, TCN3, gastric intrinsic factor |
| This gene is a member of the cobalamin transport protein family. It encodes a glycoprotein secreted by parietal cells of the gastric mucosa and is required for adequate absorption of vitamin B12. Vitamin B12 is necessary for erythrocyte maturation and mutations in this gene may lead to congenital pernicious anemia. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 42kDa/45kDa |
| NCBI: | 2694 |
| UniProt: | P27352 |
| Reinheit: | Affinity purification |
| Sequenz: | STQTQSSCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILP |
| Target-Kategorie: | CBLIF |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Endocrine & Metabolism. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Mouse stomach, using GIF Rabbit pAb (A24479) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 3s. |
Produktgarantie und fachkundiger Support
