GIF Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A24479
- Images (1)
| Article Name: | GIF Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A24479 |
| Supplier Catalog Number: | A24479 |
| Alternative Catalog Number: | ABB-A24479-100UL,ABB-A24479-20UL,ABB-A24479-500UL,ABB-A24479-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | GIF, IF, IFMH, INF, TCN3, gastric intrinsic factor |
| This gene is a member of the cobalamin transport protein family. It encodes a glycoprotein secreted by parietal cells of the gastric mucosa and is required for adequate absorption of vitamin B12. Vitamin B12 is necessary for erythrocyte maturation and mutations in this gene may lead to congenital pernicious anemia. |
| Clonality: | Polyclonal |
| Molecular Weight: | 42kDa/45kDa |
| NCBI: | 2694 |
| UniProt: | P27352 |
| Purity: | Affinity purification |
| Sequence: | STQTQSSCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILP |
| Target: | CBLIF |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Endocrine & Metabolism. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Mouse stomach, using GIF Rabbit pAb (A24479) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 3s. |
Product Guarantee and Expert Support
