Mouse PlGF Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A24547
- Bilder (1)
| Artikelname: | Mouse PlGF Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A24547 |
| Hersteller Artikelnummer: | A24547 |
| Alternativnummer: | ABB-A24547-100UL,ABB-A24547-20UL,ABB-A24547-500UL,ABB-A24547-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Mouse |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PIGF, Plgf, Mouse PlGF |
| Predicted to enable identical protein binding activity, receptor ligand activity, and vascular endothelial growth factor receptor binding activity. Acts upstream of or within branching involved in ureteric bud morphogenesis and regulation of morphogenesis of a branching structure. Located in extracellular space. Is expressed in several structures, including brain, gut gland, musculature, reproductive system, and urinary system. Human ortholog(s) of this gene implicated in several diseases, including brain ischemia, diabetic neuropathy, glioblastoma, myocardial infarction, and pancreatic endocrine carcinoma. Orthologous to human PGF (placental growth factor). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 17kDa |
| NCBI: | 18654 |
| UniProt: | P49764 |
| Reinheit: | Affinity purification |
| Sequenz: | ALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP |
| Target-Kategorie: | Pgf |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Mouse heart, using Mouse PlGF Rabbit pAb (A24547) at 1:2000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s. |
Produktgarantie und fachkundiger Support
