Mouse PlGF Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A24547
Article Name: Mouse PlGF Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A24547
Supplier Catalog Number: A24547
Alternative Catalog Number: ABB-A24547-100UL,ABB-A24547-20UL,ABB-A24547-500UL,ABB-A24547-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PIGF, Plgf, Mouse PlGF
Predicted to enable identical protein binding activity, receptor ligand activity, and vascular endothelial growth factor receptor binding activity. Acts upstream of or within branching involved in ureteric bud morphogenesis and regulation of morphogenesis of a branching structure. Located in extracellular space. Is expressed in several structures, including brain, gut gland, musculature, reproductive system, and urinary system. Human ortholog(s) of this gene implicated in several diseases, including brain ischemia, diabetic neuropathy, glioblastoma, myocardial infarction, and pancreatic endocrine carcinoma. Orthologous to human PGF (placental growth factor).
Clonality: Polyclonal
Molecular Weight: 17kDa
NCBI: 18654
UniProt: P49764
Purity: Affinity purification
Sequence: ALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP
Target: Pgf
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. Shipping: Ice Bag
Western blot analysis of lysates from Mouse heart, using Mouse PlGF Rabbit pAb (A24547) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.