CD99 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A24663
Artikelname: CD99 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A24663
Hersteller Artikelnummer: A24663
Alternativnummer: ABB-A24663-100UL,ABB-A24663-20UL,ABB-A24663-500UL,ABB-A24663-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MIC2, HBA71, MIC2X, MIC2Y, MSK5X, CD99
The protein encoded by this gene is a cell surface glycoprotein involved in leukocyte migration, T-cell adhesion, ganglioside GM1 and transmembrane protein transport, and T-cell death by a caspase-independent pathway. In addition, the encoded protein may have the ability to rearrange the actin cytoskeleton and may also act as an oncosuppressor in osteosarcoma. This gene is found in the pseudoautosomal region of chromosomes X and Y and escapes X-chromosome inactivation. There is a related pseudogene located immediately adjacent to this locus.
Klonalität: Polyclonal
Molekulargewicht: 19kDa
NCBI: 4267
UniProt: P14209
Reinheit: Affinity purification
Sequenz: DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAP
Target-Kategorie: CD99
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Immunology Inflammation,CDs. Shipping: Ice Bag
Western blot analysis of various lysates, using CD99 Rabbit pAb (A24663) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC):CHO
Exposure time: 90s.