CD99 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A24663
Article Name: CD99 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A24663
Supplier Catalog Number: A24663
Alternative Catalog Number: ABB-A24663-100UL,ABB-A24663-20UL,ABB-A24663-500UL,ABB-A24663-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: MIC2, HBA71, MIC2X, MIC2Y, MSK5X, CD99
The protein encoded by this gene is a cell surface glycoprotein involved in leukocyte migration, T-cell adhesion, ganglioside GM1 and transmembrane protein transport, and T-cell death by a caspase-independent pathway. In addition, the encoded protein may have the ability to rearrange the actin cytoskeleton and may also act as an oncosuppressor in osteosarcoma. This gene is found in the pseudoautosomal region of chromosomes X and Y and escapes X-chromosome inactivation. There is a related pseudogene located immediately adjacent to this locus.
Clonality: Polyclonal
Molecular Weight: 19kDa
NCBI: 4267
UniProt: P14209
Purity: Affinity purification
Sequence: DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAP
Target: CD99
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Immunology Inflammation,CDs. Shipping: Ice Bag
Western blot analysis of various lysates, using CD99 Rabbit pAb (A24663) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC):CHO
Exposure time: 90s.