PRELID3B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A24760
Artikelname: PRELID3B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A24760
Hersteller Artikelnummer: A24760
Alternativnummer: ABB-A24760-100UL,ABB-A24760-20UL,ABB-A24760-500UL,ABB-A24760-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: SLMO2, C20orf45, dJ543J19.5, PRELID3B
Predicted to enable phosphatidic acid transfer activity. Predicted to be involved in phospholipid transport. Predicted to be active in mitochondrial intermembrane space.
Klonalität: Polyclonal
Molekulargewicht: 21kDa
NCBI: 51012
UniProt: Q9Y3B1
Reinheit: Affinity purification
Sequenz: EHSVVDPVEKTMELKSTNISFTNMVSVDERLIYKPHPQDPEKTVLTQEAIITVKGVSLSSYLEGLMASTISSNASKGREAMEWVIHKLNAEIEELTASARG
Target-Kategorie: PRELID3B
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Metabolism, Pathways and Processes, Mitochondrial Metabolism, Mitochondrial markers. Shipping: Ice Bag
Western blot analysis of lysates from 293T cells usingPRELID3B Rabbit pAb (A24760) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.