PRELID3B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A24760
Article Name: PRELID3B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A24760
Supplier Catalog Number: A24760
Alternative Catalog Number: ABB-A24760-100UL,ABB-A24760-20UL,ABB-A24760-500UL,ABB-A24760-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SLMO2, C20orf45, dJ543J19.5, PRELID3B
Predicted to enable phosphatidic acid transfer activity. Predicted to be involved in phospholipid transport. Predicted to be active in mitochondrial intermembrane space.
Clonality: Polyclonal
Molecular Weight: 21kDa
NCBI: 51012
UniProt: Q9Y3B1
Purity: Affinity purification
Sequence: EHSVVDPVEKTMELKSTNISFTNMVSVDERLIYKPHPQDPEKTVLTQEAIITVKGVSLSSYLEGLMASTISSNASKGREAMEWVIHKLNAEIEELTASARG
Target: PRELID3B
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Metabolism, Pathways and Processes, Mitochondrial Metabolism, Mitochondrial markers. Shipping: Ice Bag
Western blot analysis of lysates from 293T cells usingPRELID3B Rabbit pAb (A24760) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.