PPARA Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A24835
Artikelname: PPARA Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A24835
Hersteller Artikelnummer: A24835
Alternativnummer: ABB-A24835-100UL,ABB-A24835-20UL,ABB-A24835-1000UL,ABB-A24835-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PPAR, NR1C1, hPPAR, PPARalpha, PPARA
Peroxisome proliferators include hypolipidemic drugs, herbicides, leukotriene antagonists, and plasticizers, this term arises because they induce an increase in the size and number of peroxisomes. Peroxisomes are subcellular organelles found in plants and animals that contain enzymes for respiration and for cholesterol and lipid metabolism. The action of peroxisome proliferators is thought to be mediated via specific receptors, called PPARs, which belong to the steroid hormone receptor superfamily. PPARs affect the expression of target genes involved in cell proliferation, cell differentiation and in immune and inflammation responses. Three closely related subtypes (alpha, beta/delta, and gamma) have been identified. This gene encodes the subtype PPAR-alpha, which is a nuclear transcription factor. Multiple alternatively spliced transcript variants have been described for this gene, although the full-length nature of only two has been determined.
Klonalität: Polyclonal
Konzentration: WB
Molekulargewicht: 52kDa
NCBI: 5465
UniProt: Q07869
Reinheit: Affinity purification
Sequenz: ADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANL
Target-Kategorie: PPARA
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Epigenetics & Nuclear Signaling,Transcription Factors,Nuclear Receptor Signaling,Nuclear hormone receptors,Cancer,Signal Transduction,Endocrine & Metabolism,Mitochondrial metabolism,Mitochondrial Biogenesis,Lipid Metabolism,Nucleotide metabolism,Molecular processes,Cardiovascular,Hypoxia,Lipids,Fatty Acids. Shipping: Ice Bag
Western blot analysis of lysates from Mouse kidney usingPPARA Rabbit pAb (A24835) at1:700 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.