ST3GAL4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A24837
Artikelname: ST3GAL4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A24837
Hersteller Artikelnummer: A24837
Alternativnummer: ABB-A24837-20UL,ABB-A24837-100UL,ABB-A24837-500UL,ABB-A24837-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ST3GAL4, CGS23, NANTA3, SAT3, SIAT4, SIAT4C, ST-4, ST3GalA.2, ST3GalIV, STZ, gal-NAc6S, ST3 beta-galactoside alpha-2, 3-sialyltransferase 4
This gene encodes a member of the glycosyltransferase 29 family, a group of enzymes involved in protein glycosylation. The encoded protein is targeted to Golgi membranes but may be proteolytically processed and secreted. The gene product may also be involved in the increased expression of sialyl Lewis X antigen seen in inflammatory responses. Multiple transcript variants encoding different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 36kDa/37kDa/38kDa
NCBI: 6484
UniProt: Q11206
Reinheit: Affinity purification
Sequenz: PFFMEIAADKLLSLPMQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSMAGSGHNVSQEALAIKRMLEMGAIKNLTSF
Target-Kategorie: ST3GAL4
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Cancer,Signal Transduction,Endocrine & Metabolism,Amino acid metabolism. Shipping: Ice Bag
Western blot analysis of lysates from Mouse liver usingST3GAL4 Rabbit pAb (A24837) at1:800 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.