ST3GAL4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A24837
Article Name: ST3GAL4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A24837
Supplier Catalog Number: A24837
Alternative Catalog Number: ABB-A24837-20UL,ABB-A24837-100UL,ABB-A24837-500UL,ABB-A24837-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ST3GAL4, CGS23, NANTA3, SAT3, SIAT4, SIAT4C, ST-4, ST3GalA.2, ST3GalIV, STZ, gal-NAc6S, ST3 beta-galactoside alpha-2, 3-sialyltransferase 4
This gene encodes a member of the glycosyltransferase 29 family, a group of enzymes involved in protein glycosylation. The encoded protein is targeted to Golgi membranes but may be proteolytically processed and secreted. The gene product may also be involved in the increased expression of sialyl Lewis X antigen seen in inflammatory responses. Multiple transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 36kDa/37kDa/38kDa
NCBI: 6484
UniProt: Q11206
Purity: Affinity purification
Sequence: PFFMEIAADKLLSLPMQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSMAGSGHNVSQEALAIKRMLEMGAIKNLTSF
Target: ST3GAL4
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. ResearchArea: Cancer,Signal Transduction,Endocrine & Metabolism,Amino acid metabolism. Shipping: Ice Bag
Western blot analysis of lysates from Mouse liver usingST3GAL4 Rabbit pAb (A24837) at1:800 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.