SLC1A7 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A24854
Artikelname: SLC1A7 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A24854
Hersteller Artikelnummer: A24854
Alternativnummer: ABB-A24854-20UL,ABB-A24854-100UL,ABB-A24854-1000UL,ABB-A24854-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: SLC1A7, AAAT, EAAT5, solute carrier family 1 member 7
Predicted to enable anion transmembrane transporter activity. Involved in neurotransmitter reuptake. Predicted to be located in plasma membrane. Predicted to be active in glutamatergic synapse. Predicted to be integral component of postsynaptic membrane and integral component of presynaptic membrane.
Klonalität: Polyclonal
Molekulargewicht: 17kDa/60kDa
NCBI: 6512
UniProt: O00341
Reinheit: Affinity purification
Sequenz: DFARDTGTEKLLPCETKPVSLQEIVAAQQNGCVKSVAEASELTLGPTCPHHVPVQVEQDEELPAASLNHCTIQISELETNV
Target-Kategorie: SLC1A7
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Signal transduction metabolic amino acids, signal transduction metabolic plasma membrane channels, metabolic pathways and processes, metabolic signaling pathways Amino acid metabolism. Shipping: Ice Bag
Western blot analysis of lysates from Mouse testis usingSLC1A7 Rabbit pAb (A24854) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.