SLC1A7 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A24854
Article Name: SLC1A7 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A24854
Supplier Catalog Number: A24854
Alternative Catalog Number: ABB-A24854-20UL,ABB-A24854-100UL,ABB-A24854-1000UL,ABB-A24854-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SLC1A7, AAAT, EAAT5, solute carrier family 1 member 7
Predicted to enable anion transmembrane transporter activity. Involved in neurotransmitter reuptake. Predicted to be located in plasma membrane. Predicted to be active in glutamatergic synapse. Predicted to be integral component of postsynaptic membrane and integral component of presynaptic membrane.
Clonality: Polyclonal
Molecular Weight: 17kDa/60kDa
NCBI: 6512
UniProt: O00341
Purity: Affinity purification
Sequence: DFARDTGTEKLLPCETKPVSLQEIVAAQQNGCVKSVAEASELTLGPTCPHHVPVQVEQDEELPAASLNHCTIQISELETNV
Target: SLC1A7
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. ResearchArea: Signal transduction metabolic amino acids, signal transduction metabolic plasma membrane channels, metabolic pathways and processes, metabolic signaling pathways Amino acid metabolism. Shipping: Ice Bag
Western blot analysis of lysates from Mouse testis usingSLC1A7 Rabbit pAb (A24854) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.