DLL4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A24862
- Bilder (1)
| Artikelname: | DLL4 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A24862 |
| Hersteller Artikelnummer: | A24862 |
| Alternativnummer: | ABB-A24862-20UL,ABB-A24862-100UL,ABB-A24862-500UL,ABB-A24862-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DLL4, AOS6, hdelta2, delta-like protein 4 |
| This gene is a homolog of the Drosophila delta gene. The delta gene family encodes Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 74kDa |
| NCBI: | 54567 |
| UniProt: | Q9NR61 |
| Reinheit: | Affinity purification |
| Sequenz: | GVFQLQLQEFINERGVLASGRPCEPGCRTFFRVCLKHFQAVVSPGPCTFGTVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIEAWHAPGDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPICLSGCHEQNGYCSKPAECLCRPGWQGRLCNECIPHNGCRHGTCSTPWQCTCDEGWGGLFCD |
| Target-Kategorie: | DLL4 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Epigenetics & Nuclear Signaling,Signal Transduction,Cell Biology & Developmental Biology,Cell Cycle,Cell differentiation,Notch Signaling Pathway,Neuroscience,Cardiovascular,Angiogenesis. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from wild type (WT) and 293T cells transfected with DLL4 using DLL4 Rabbit pAb (A24862) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 20s. |
Produktgarantie und fachkundiger Support
