DLL4 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A24862
- Images (1)
| Article Name: | DLL4 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A24862 |
| Supplier Catalog Number: | A24862 |
| Alternative Catalog Number: | ABB-A24862-20UL,ABB-A24862-100UL,ABB-A24862-500UL,ABB-A24862-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | DLL4, AOS6, hdelta2, delta-like protein 4 |
| This gene is a homolog of the Drosophila delta gene. The delta gene family encodes Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain. |
| Clonality: | Polyclonal |
| Molecular Weight: | 74kDa |
| NCBI: | 54567 |
| UniProt: | Q9NR61 |
| Purity: | Affinity purification |
| Sequence: | GVFQLQLQEFINERGVLASGRPCEPGCRTFFRVCLKHFQAVVSPGPCTFGTVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIEAWHAPGDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPICLSGCHEQNGYCSKPAECLCRPGWQGRLCNECIPHNGCRHGTCSTPWQCTCDEGWGGLFCD |
| Target: | DLL4 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human. ResearchArea: Epigenetics & Nuclear Signaling,Signal Transduction,Cell Biology & Developmental Biology,Cell Cycle,Cell differentiation,Notch Signaling Pathway,Neuroscience,Cardiovascular,Angiogenesis. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from wild type (WT) and 293T cells transfected with DLL4 using DLL4 Rabbit pAb (A24862) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 20s. |
Product Guarantee and Expert Support
