SFTPA1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A24870
- Bilder (1)
| Artikelname: | SFTPA1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A24870 |
| Hersteller Artikelnummer: | A24870 |
| Alternativnummer: | ABB-A24870-20UL,ABB-A24870-1000UL,ABB-A24870-500UL,ABB-A24870-100UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | SPA, ILD1, PSAP, PSPA, SP-A, SPA1, PSP-A, SFTP1, SP-A1, COLEC4, SFTPA1B, SP-A1 beta, SP-A1 delta, SP-A1 gamma, SP-A1 epsilon, SFTPA1 |
| This gene encodes a lung surfactant protein that is a member of a subfamily of C-type lectins called collectins. The encoded protein binds specific carbohydrate moieties found on lipids and on the surface of microorganisms. This protein plays an essential role in surfactant homeostasis and in the defense against respiratory pathogens. Mutations in this gene are associated with idiopathic pulmonary fibrosis. Alternate splicing results in multiple transcript variants. |
| Klonalität: | Polyclonal |
| Konzentration: | WB |
| Molekulargewicht: | 26kDa |
| NCBI: | 653509 |
| UniProt: | Q8IWL2 |
| Reinheit: | Affinity purification |
| Sequenz: | PAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF |
| Target-Kategorie: | SFTPA1/SFTPA2 |
| Application Verdünnung: | WB,1:1000 - 1:5000 |
| Anwendungsbeschreibung: | Cross-Reactivity: Rat. ResearchArea: Cytoskeleton,Extracellular Matrix. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Rat lung usingSurfactant Protein A/SP-A Rabbit pAb (A24870) at1:2000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time:20s. |
Produktgarantie und fachkundiger Support
