SFTPA1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A24870
Article Name: SFTPA1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A24870
Supplier Catalog Number: A24870
Alternative Catalog Number: ABB-A24870-20UL,ABB-A24870-1000UL,ABB-A24870-500UL,ABB-A24870-100UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SPA, ILD1, PSAP, PSPA, SP-A, SPA1, PSP-A, SFTP1, SP-A1, COLEC4, SFTPA1B, SP-A1 beta, SP-A1 delta, SP-A1 gamma, SP-A1 epsilon, SFTPA1
This gene encodes a lung surfactant protein that is a member of a subfamily of C-type lectins called collectins. The encoded protein binds specific carbohydrate moieties found on lipids and on the surface of microorganisms. This protein plays an essential role in surfactant homeostasis and in the defense against respiratory pathogens. Mutations in this gene are associated with idiopathic pulmonary fibrosis. Alternate splicing results in multiple transcript variants.
Clonality: Polyclonal
Concentration: WB
Molecular Weight: 26kDa
NCBI: 653509
UniProt: Q8IWL2
Purity: Affinity purification
Sequence: PAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF
Target: SFTPA1/SFTPA2
Application Dilute: WB,1:1000 - 1:5000
Application Notes: Cross-Reactivity: Rat. ResearchArea: Cytoskeleton,Extracellular Matrix. Shipping: Ice Bag
Western blot analysis of lysates from Rat lung usingSurfactant Protein A/SP-A Rabbit pAb (A24870) at1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:20s.