CCL8/MCP-2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A24871
Artikelname: CCL8/MCP-2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A24871
Hersteller Artikelnummer: A24871
Alternativnummer: ABB-A24871-20UL,ABB-A24871-100UL,ABB-A24871-1000UL,ABB-A24871-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CCL8, HC14, MCP-2, MCP2, SCYA10, SCYA8, C-C motif chemokine 8, CCL8/MCP-2
This antimicrobial gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of N-terminal cysteine residues of the mature peptide. This chemokine is a member of the CC subfamily which is characterized by two adjacent cysteine residues. This cytokine displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils. By recruiting leukocytes to sites of inflammation this cytokine may contribute to tumor-associated leukocyte infiltration and to the antiviral state against HIV infection.
Klonalität: Polyclonal
Konzentration: WB
Molekulargewicht: 11kDa
NCBI: 6355
UniProt: P80075
Reinheit: Affinity purification
Sequenz: QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
Target-Kategorie: CCL8
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Immunology & Inflammation,Cytokines,Cell Intrinsic Innate Immunity Signaling Pathway,Chemokines,Chemokine. Shipping: Ice Bag
Western blot analysis of lysates from wild type (WT) and293T cells transfected withCCL8/MCP-2 usingCCL8/MCP-2 Rabbit pAb (A24871) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:180s.